PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014662-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 785aa    MW: 84694 Da    PI: 6.1597
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014662-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.62.6e-33325382260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgsefprsYY+Ct+++C+vkkkvers  d++++ei+Y+g Hnh+k
  NNU_014662-RA 325 EDGYNWRKYGQKQVKGSEFPRSYYKCTHQNCQVKKKVERSL-DGQITEIIYKGAHNHPK 382
                    7****************************************.***************85 PP

2WRKY1048e-33525583159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnhe
  NNU_014662-RA 525 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCSVRKHVERASHDLKSVITTYEGKHNHE 583
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-29322383IPR003657WRKY domain
SuperFamilySSF1182906.54E-26323383IPR003657WRKY domain
SMARTSM007746.2E-38324382IPR003657WRKY domain
PfamPF031069.1E-26325381IPR003657WRKY domain
PROSITE profilePS5081123.56325383IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.0E-37510585IPR003657WRKY domain
SuperFamilySSF1182902.62E-28517585IPR003657WRKY domain
PROSITE profilePS5081138.308520585IPR003657WRKY domain
SMARTSM007742.1E-37525584IPR003657WRKY domain
PfamPF031064.9E-25526583IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MAETDENGDW RGLMASPRGL FSAFISDGFA SRSSLNGTDA APASADGEPV SSERKAEDAG  60
GAAGRSIGSG VNALTEVSSV WKPEGVRNGA SIAERRAAIC GFSAPRINTA RFRSVSPLSS  120
PGVCSPYLTI PPGLSPTTLL DSPVMLPNSQ PSPTTGTFQL PPLGQEGSME VAVTSNSDKE  180
KSDDSDASFM FKPHVNPDSL PGLSGVVNHA CSPNQTQNLE KSGSNHQGHA RVQQQVDFEC  240
QTGFPKPAML ADCTTNLHSD AEVSNNMIVD NKFIALQTCH SGVASDQAPL IEEPVHGEDN  300
GSQQQLLEGD QKGSYASLGL GRPSEDGYNW RKYGQKQVKG SEFPRSYYKC THQNCQVKKK  360
VERSLDGQIT EIIYKGAHNH PKPQPNRRSA IGSALPFNDM PETDWRADGL ERTSSTSVLT  420
ELSDPLSTAQ GKHVSMVDSA DTPELSSTLA SHEDDEDRAT QGSISVGDDG DDDESESKRR  480
GKTLTMICDY FLRKKESCLI ETSLASRAVR EPRVVVQTTS EVDILDDGYR WRKYGQKVVK  540
GNPNPRSYYK CTSAGCSVRK HVERASHDLK SVITTYEGKH NHEVPAARNS SHVNPGAGNI  600
PPAGPNVQTA LTLPGSTNFP KPEPQIQDLA PRFERKPDFG NEFLRTGYLG GFSSDIKLGT  660
SCYELKLPPL QTAMPFGSFG LNPSHGDAHQ MASIAQLPEF PMSLPLSSLP RPANLGLTGY  720
DFSGKTIGPT QSLLGVQPPK ETDTRFLRPK QEQKDDAAYD THAPINHLGN ASSSIYRQMM  780
GSYPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-36325586878Probable WRKY transcription factor 4
2lex_A5e-36325586878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268324.10.0PREDICTED: probable WRKY transcription factor 2 isoform X1
TrEMBLM5WG220.0M5WG22_PRUPE; Uncharacterized protein (Fragment)
STRINGGLYMA18G47741.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.17e-92WRKY DNA-binding protein 2